Anti MARVELD2 pAb (ATL-HPA061726)

Atlas Antibodies

SKU: ATL-HPA061726-25

• 

Protein Description: MARVEL domain containing 2
Gene Name: MARVELD2
Alternative Gene Name: DFNB49, FLJ30532, MRVLDC2, TRIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021636: 85%, ENSRNOG00000052167: 86%
Entrez Gene ID: 153562
Uniprot ID: Q8N4S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDY
• Gene Sequence: LKLWRHEAARRHREYMEQQEINEPSLSSKRKMCEMATSGDRQRDSEVNFKELRTAKMKPELLSGHIPPGHIPKPIVMPDY
• Gene ID - Mouse: ENSMUSG00000021636
• Gene ID - Rat: ENSRNOG00000052167
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.