Anti MARVELD2 pAb (ATL-HPA018119)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018119-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: MARVELD2
Alternative Gene Name: DFNB49, FLJ30532, MRVLDC2, TRIC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021636: 94%, ENSRNOG00000052167: 93%
Entrez Gene ID: 153562
Uniprot ID: Q8N4S9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDV |
| Gene Sequence | AKYPVIQTDDERERYKAVFQDQFSEYKELSAEVQAVLRKFDELDAVMSRLPHHSESRQEHERISRIHEEFKKKKNDPTFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDV |
| Gene ID - Mouse | ENSMUSG00000021636 |
| Gene ID - Rat | ENSRNOG00000052167 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MARVELD2 pAb (ATL-HPA018119) | |
| Datasheet | Anti MARVELD2 pAb (ATL-HPA018119) Datasheet (External Link) |
| Vendor Page | Anti MARVELD2 pAb (ATL-HPA018119) at Atlas Antibodies |
| Documents & Links for Anti MARVELD2 pAb (ATL-HPA018119) | |
| Datasheet | Anti MARVELD2 pAb (ATL-HPA018119) Datasheet (External Link) |
| Vendor Page | Anti MARVELD2 pAb (ATL-HPA018119) |