Anti MARK2 pAb (ATL-HPA074905)

Atlas Antibodies

SKU:
ATL-HPA074905-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & plasma membrane.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: MAP/microtubule affinity-regulating kinase 2
Gene Name: MARK2
Alternative Gene Name: EMK1, PAR-1, PAR-1B, Par1b
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024969: 93%, ENSRNOG00000021184: 70%
Entrez Gene ID: 2011
Uniprot ID: Q7KZI7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMS
Gene Sequence EDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRSRNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKSMS
Gene ID - Mouse ENSMUSG00000024969
Gene ID - Rat ENSRNOG00000021184
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MARK2 pAb (ATL-HPA074905)
Datasheet Anti MARK2 pAb (ATL-HPA074905) Datasheet (External Link)
Vendor Page Anti MARK2 pAb (ATL-HPA074905) at Atlas Antibodies

Documents & Links for Anti MARK2 pAb (ATL-HPA074905)
Datasheet Anti MARK2 pAb (ATL-HPA074905) Datasheet (External Link)
Vendor Page Anti MARK2 pAb (ATL-HPA074905)