Anti MARCO pAb (ATL-HPA063793 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063793-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MARCO
Alternative Gene Name: SCARA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026390: 52%, ENSRNOG00000049303: 57%
Entrez Gene ID: 8685
Uniprot ID: Q9UEW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV |
| Gene Sequence | LNLQARLRVLEMYFLNDTLAAEDSPSFSLLQSAHPGEHLAQGASRLQVLQAQLTWVRV |
| Gene ID - Mouse | ENSMUSG00000026390 |
| Gene ID - Rat | ENSRNOG00000049303 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MARCO pAb (ATL-HPA063793 w/enhanced validation) | |
| Datasheet | Anti MARCO pAb (ATL-HPA063793 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MARCO pAb (ATL-HPA063793 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti MARCO pAb (ATL-HPA063793 w/enhanced validation) | |
| Datasheet | Anti MARCO pAb (ATL-HPA063793 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti MARCO pAb (ATL-HPA063793 w/enhanced validation) |
| Citations for Anti MARCO pAb (ATL-HPA063793 w/enhanced validation) – 5 Found |
| Lundgren, Sebastian; Karnevi, Emelie; Elebro, Jacob; Nodin, Björn; Karlsson, Mikael C I; Eberhard, Jakob; Leandersson, Karin; Jirström, Karin. The clinical importance of tumour-infiltrating macrophages and dendritic cells in periampullary adenocarcinoma differs by morphological subtype. Journal Of Translational Medicine. 2017;15(1):152. PubMed |
| Xiang, Menglan; Grosso, Rubén Adrián; Takeda, Akira; Pan, Junliang; Bekkhus, Tove; Brulois, Kevin; Dermadi, Denis; Nordling, Sofia; Vanlandewijck, Michael; Jalkanen, Sirpa; Ulvmar, Maria H; Butcher, Eugene C. A Single-Cell Transcriptional Roadmap of the Mouse and Human Lymph Node Lymphatic Vasculature. Frontiers In Cardiovascular Medicine. 7( 32426372):52. PubMed |
| Jeremiasen, Martin; Borg, David; Hedner, Charlotta; Svensson, Maria; Nodin, Björn; Leandersson, Karin; Johansson, Jan; Jirström, Karin. Tumor-Associated CD68(+), CD163(+), and MARCO(+) Macrophages as Prognostic Biomarkers in Patients With Treatment-Naïve Gastroesophageal Adenocarcinoma. Frontiers In Oncology. 10( 33194593):534761. PubMed |
| Liu, Yuming; Zhang, Jinmai; Wang, Zhuo; Ma, Jiaqiang; Wang, Ke; Rao, Dongning; Zhang, Mao; Lin, Youpei; Wu, Yingcheng; Yang, Zijian; Dong, Liangqing; Ding, Zhenbin; Zhang, Xiaoming; Fan, Jia; Shi, Yongyong; Gao, Qiang. Multi-omics characterization reveals the pathogenesis of liver focal nodular hyperplasia. Iscience. 2022;25(9):104921. PubMed |
| Svensson, Maria C; Svensson, Maja; Nodin, Björn; Borg, David; Hedner, Charlotta; Hjalmarsson, Claes; Leandersson, Karin; Jirström, Karin. High Infiltration of CD68+/CD163- Macrophages Is an Adverse Prognostic Factor after Neoadjuvant Chemotherapy in Esophageal and Gastric Adenocarcinoma. Journal Of Innate Immunity. 14(6):615-628. PubMed |