Anti MARCKS pAb (ATL-HPA054820)

Atlas Antibodies

Catalog No.:
ATL-HPA054820-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: myristoylated alanine-rich protein kinase C substrate
Gene Name: MARCKS
Alternative Gene Name: 80K-L, MACS, PKCSL
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069662: 97%, ENSRNOG00000000579: 100%
Entrez Gene ID: 4082
Uniprot ID: P29966
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ
Gene Sequence MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQ
Gene ID - Mouse ENSMUSG00000069662
Gene ID - Rat ENSRNOG00000000579
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MARCKS pAb (ATL-HPA054820)
Datasheet Anti MARCKS pAb (ATL-HPA054820) Datasheet (External Link)
Vendor Page Anti MARCKS pAb (ATL-HPA054820) at Atlas Antibodies

Documents & Links for Anti MARCKS pAb (ATL-HPA054820)
Datasheet Anti MARCKS pAb (ATL-HPA054820) Datasheet (External Link)
Vendor Page Anti MARCKS pAb (ATL-HPA054820)