Anti MARCH6 pAb (ATL-HPA063246)

Atlas Antibodies

Catalog No.:
ATL-HPA063246-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: membrane-associated ring finger (C3HC4) 6, E3 ubiquitin protein ligase
Gene Name: MARCH6
Alternative Gene Name: MARCH-VI, RNF176, TEB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039100: 90%, ENSRNOG00000011066: 90%
Entrez Gene ID: 10299
Uniprot ID: O60337
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQDDQAEEE
Gene Sequence GAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQDDQAEEE
Gene ID - Mouse ENSMUSG00000039100
Gene ID - Rat ENSRNOG00000011066
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MARCH6 pAb (ATL-HPA063246)
Datasheet Anti MARCH6 pAb (ATL-HPA063246) Datasheet (External Link)
Vendor Page Anti MARCH6 pAb (ATL-HPA063246) at Atlas Antibodies

Documents & Links for Anti MARCH6 pAb (ATL-HPA063246)
Datasheet Anti MARCH6 pAb (ATL-HPA063246) Datasheet (External Link)
Vendor Page Anti MARCH6 pAb (ATL-HPA063246)