Anti MARCH6 pAb (ATL-HPA063246)

Atlas Antibodies

Catalog No.: ATL-HPA063246-25

Protein Description: membrane-associated ring finger (C3HC4) 6, E3 ubiquitin protein ligase
Gene Name: MARCH6
Alternative Gene Name: MARCH-VI, RNF176, TEB4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039100: 90%, ENSRNOG00000011066: 90%
Entrez Gene ID: 10299
Uniprot ID: O60337
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQDDQAEEE
• Gene Sequence: GAPIWLEHAAPPFNAAGHHQNEAPAGGNGAENVAADQPANPPAENAVVGENPDAQDDQAEEE
• Gene ID - Mouse: ENSMUSG00000039100
• Gene ID - Rat: ENSRNOG00000011066
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.