Anti MARCH5 pAb (ATL-HPA056596)

Atlas Antibodies

Catalog No.:
ATL-HPA056596-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: membrane-associated ring finger (C3HC4) 5
Gene Name: MARCH5
Alternative Gene Name: FLJ20445, MARCH-V, RNF153
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000111123: 100%, ENSRNOG00000017396: 100%
Entrez Gene ID: 54708
Uniprot ID: Q9NX47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLA
Gene Sequence PDQALQQMLDRSCWVCFATDEDDRTAEWVRPCRCRGSTKWVHQACLQRWVDEKQRGNSTARVACPQCNAEYLIVFPKLGPVVYVLDLA
Gene ID - Mouse ENSMUSG00000111123
Gene ID - Rat ENSRNOG00000017396
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MARCH5 pAb (ATL-HPA056596)
Datasheet Anti MARCH5 pAb (ATL-HPA056596) Datasheet (External Link)
Vendor Page Anti MARCH5 pAb (ATL-HPA056596) at Atlas Antibodies

Documents & Links for Anti MARCH5 pAb (ATL-HPA056596)
Datasheet Anti MARCH5 pAb (ATL-HPA056596) Datasheet (External Link)
Vendor Page Anti MARCH5 pAb (ATL-HPA056596)