Anti MARCH4 pAb (ATL-HPA014348)

Atlas Antibodies

Catalog No.: ATL-HPA014348-25

Protein Description: membrane-associated ring finger (C3HC4) 4, E3 ubiquitin protein ligase
Gene Name: MARCH4
Alternative Gene Name: KIAA1399, MARCH-IV, RNF174
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039372: 79%, ENSRNOG00000016472: 78%
Entrez Gene ID: 57574
Uniprot ID: Q9P2E8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQRSP
• Gene Sequence: WKVLNYDKTKDLEDQKAGGRTNPRTSSSTQANIPSSEEETAGTPAPEQGPAQAAGHPSGPLSHHHCAYTILHILSHLRPHEQRSP
• Gene ID - Mouse: ENSMUSG00000039372
• Gene ID - Rat: ENSRNOG00000016472
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.