Anti MARCH1 pAb (ATL-HPA014600)

Atlas Antibodies

Catalog No.: ATL-HPA014600-25

Protein Description: membrane-associated ring finger (C3HC4) 1, E3 ubiquitin protein ligase
Gene Name: MARCH1
Alternative Gene Name: FLJ20668, MARCH-I, RNF171
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036469: 89%, ENSRNOG00000026310: 87%
Entrez Gene ID: 55016
Uniprot ID: Q8TCQ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGG
• Gene Sequence: KVYVQLWRRLKAYNRVIFVQNCPDTAKKLEKNFSCNVNTDIKDAVVVPVPQTGANSLPSAEGG
• Gene ID - Mouse: ENSMUSG00000036469
• Gene ID - Rat: ENSRNOG00000026310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.