Anti MARC2 pAb (ATL-HPA015085 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA015085-25

Protein Description: mitochondrial amidoxime reducing component 2
Gene Name: MARC2
Alternative Gene Name: FLJ20605, MOSC2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073481: 74%, ENSRNOG00000052159: 74%
Entrez Gene ID: 54996
Uniprot ID: Q969Z3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FQVAYPDYCPLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPDTGVIDRKQPLDTLKSYRL
• Gene Sequence: FQVAYPDYCPLLIMTDASLVDLNTRMEKKMKMENFRPNIVVTGCDAFEEDTWDELLIGSVEVKKVMACPRCILTTVDPDTGVIDRKQPLDTLKSYRL
• Gene ID - Mouse: ENSMUSG00000073481
• Gene ID - Rat: ENSRNOG00000052159
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MARC2 pAb (ATL-HPA015085 w/enhanced validation) – 5 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Jakobs, Heyka H; Mikula, Michal; Havemeyer, Antje; Strzalkowska, Adriana; Borowa-Chmielak, Monika; Dzwonek, Artur; Gajewska, Marta; Hennig, Ewa E; Ostrowski, Jerzy; Clement, Bernd. The N-reductive system composed of mitochondrial amidoxime reducing component (mARC), cytochrome b5 (CYB5B) and cytochrome b5 reductase (CYB5R) is regulated by fasting and high fat diet in mice. Plos One. 9(8):e105371. 

Thinon, Emmanuelle; Serwa, Remigiusz A; Broncel, Malgorzata; Brannigan, James A; Brassat, Ute; Wright, Megan H; Heal, William P; Wilkinson, Anthony J; Mann, David J; Tate, Edward W. Global profiling of co- and post-translationally N-myristoylated proteomes in human cells. Nature Communications. 2014;5( 25255805):4919. 

Neve, Etienne P A; Köfeler, Harald; Hendriks, Delilah F G; Nordling, Åsa; Gogvadze, Vladimir; Mkrtchian, Souren; Näslund, Erik; Ingelman-Sundberg, Magnus. Expression and Function of mARC: Roles in Lipogenesis and Metabolic Activation of Ximelagatran. Plos One. 10(9):e0138487. 

Rixen, Sophia; Havemeyer, Antje; Tyl-Bielicka, Anita; Pysniak, Kazimiera; Gajewska, Marta; Kulecka, Maria; Ostrowski, Jerzy; Mikula, Michal; Clement, Bernd. Mitochondrial amidoxime-reducing component 2 (MARC2) has a significant role in N-reductive activity and energy metabolism. The Journal Of Biological Chemistry. 2019;294(46):17593-17602.