Anti MAPKAPK2 pAb (ATL-HPA064435)
Atlas Antibodies
- SKU:
- ATL-HPA064435-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MAPKAPK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016528: 95%, ENSRNOG00000004726: 92%
Entrez Gene ID: 9261
Uniprot ID: P49137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL |
Gene Sequence | TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL |
Gene ID - Mouse | ENSMUSG00000016528 |
Gene ID - Rat | ENSRNOG00000004726 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MAPKAPK2 pAb (ATL-HPA064435) | |
Datasheet | Anti MAPKAPK2 pAb (ATL-HPA064435) Datasheet (External Link) |
Vendor Page | Anti MAPKAPK2 pAb (ATL-HPA064435) at Atlas Antibodies |
Documents & Links for Anti MAPKAPK2 pAb (ATL-HPA064435) | |
Datasheet | Anti MAPKAPK2 pAb (ATL-HPA064435) Datasheet (External Link) |
Vendor Page | Anti MAPKAPK2 pAb (ATL-HPA064435) |