Anti MAPKAPK2 pAb (ATL-HPA045556)
Atlas Antibodies
- Catalog No.:
- ATL-HPA045556-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: MAPKAPK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016528: 95%, ENSRNOG00000004726: 92%
Entrez Gene ID: 9261
Uniprot ID: P49137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL |
| Gene Sequence | TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL |
| Gene ID - Mouse | ENSMUSG00000016528 |
| Gene ID - Rat | ENSRNOG00000004726 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAPKAPK2 pAb (ATL-HPA045556) | |
| Datasheet | Anti MAPKAPK2 pAb (ATL-HPA045556) Datasheet (External Link) |
| Vendor Page | Anti MAPKAPK2 pAb (ATL-HPA045556) at Atlas Antibodies |
| Documents & Links for Anti MAPKAPK2 pAb (ATL-HPA045556) | |
| Datasheet | Anti MAPKAPK2 pAb (ATL-HPA045556) Datasheet (External Link) |
| Vendor Page | Anti MAPKAPK2 pAb (ATL-HPA045556) |