Anti MAPKAPK2 pAb (ATL-HPA045556)

Atlas Antibodies

Catalog No.: ATL-HPA045556-25

Protein Description: mitogen-activated protein kinase-activated protein kinase 2
Gene Name: MAPKAPK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016528: 95%, ENSRNOG00000004726: 92%
Entrez Gene ID: 9261
Uniprot ID: P49137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL
• Gene Sequence: TMRVDYEQIKIKKIEDASNPLLLKRRKKARALEAAAL
• Gene ID - Mouse: ENSMUSG00000016528
• Gene ID - Rat: ENSRNOG00000004726
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.