Anti MAPK12 pAb (ATL-HPA054562)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054562-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: MAPK12
Alternative Gene Name: ERK6, p38gamma, PRKM12, SAPK-3, SAPK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022610: 87%, ENSRNOG00000031233: 88%
Entrez Gene ID: 6300
Uniprot ID: P53778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV |
| Gene Sequence | FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV |
| Gene ID - Mouse | ENSMUSG00000022610 |
| Gene ID - Rat | ENSRNOG00000031233 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAPK12 pAb (ATL-HPA054562) | |
| Datasheet | Anti MAPK12 pAb (ATL-HPA054562) Datasheet (External Link) |
| Vendor Page | Anti MAPK12 pAb (ATL-HPA054562) at Atlas Antibodies |
| Documents & Links for Anti MAPK12 pAb (ATL-HPA054562) | |
| Datasheet | Anti MAPK12 pAb (ATL-HPA054562) Datasheet (External Link) |
| Vendor Page | Anti MAPK12 pAb (ATL-HPA054562) |