Anti MAPK12 pAb (ATL-HPA054562)

Atlas Antibodies

SKU: ATL-HPA054562-25

• 
• 

Protein Description: mitogen-activated protein kinase 12
Gene Name: MAPK12
Alternative Gene Name: ERK6, p38gamma, PRKM12, SAPK-3, SAPK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022610: 87%, ENSRNOG00000031233: 88%
Entrez Gene ID: 6300
Uniprot ID: P53778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV
• Gene Sequence: FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV
• Gene ID - Mouse: ENSMUSG00000022610
• Gene ID - Rat: ENSRNOG00000031233
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.