Anti MAPK12 pAb (ATL-HPA054562)

Atlas Antibodies

Catalog No.:
ATL-HPA054562-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: mitogen-activated protein kinase 12
Gene Name: MAPK12
Alternative Gene Name: ERK6, p38gamma, PRKM12, SAPK-3, SAPK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022610: 87%, ENSRNOG00000031233: 88%
Entrez Gene ID: 6300
Uniprot ID: P53778
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV
Gene Sequence FKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAV
Gene ID - Mouse ENSMUSG00000022610
Gene ID - Rat ENSRNOG00000031233
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAPK12 pAb (ATL-HPA054562)
Datasheet Anti MAPK12 pAb (ATL-HPA054562) Datasheet (External Link)
Vendor Page Anti MAPK12 pAb (ATL-HPA054562) at Atlas Antibodies

Documents & Links for Anti MAPK12 pAb (ATL-HPA054562)
Datasheet Anti MAPK12 pAb (ATL-HPA054562) Datasheet (External Link)
Vendor Page Anti MAPK12 pAb (ATL-HPA054562)