Anti MAPK11 pAb (ATL-HPA045069)

Atlas Antibodies

Catalog No.: ATL-HPA045069-25

Protein Description: mitogen-activated protein kinase 11
Gene Name: MAPK11
Alternative Gene Name: p38-2, p38Beta, PRKM11, SAPK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053137: 96%, ENSRNOG00000006984: 96%
Entrez Gene ID: 5600
Uniprot ID: Q15759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA
• Gene Sequence: DYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA
• Gene ID - Mouse: ENSMUSG00000053137
• Gene ID - Rat: ENSRNOG00000006984
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.