Anti MAPK11 pAb (ATL-HPA045069)

Atlas Antibodies

Catalog No.:
ATL-HPA045069-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: mitogen-activated protein kinase 11
Gene Name: MAPK11
Alternative Gene Name: p38-2, p38Beta, PRKM11, SAPK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053137: 96%, ENSRNOG00000006984: 96%
Entrez Gene ID: 5600
Uniprot ID: Q15759
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA
Gene Sequence DYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA
Gene ID - Mouse ENSMUSG00000053137
Gene ID - Rat ENSRNOG00000006984
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAPK11 pAb (ATL-HPA045069)
Datasheet Anti MAPK11 pAb (ATL-HPA045069) Datasheet (External Link)
Vendor Page Anti MAPK11 pAb (ATL-HPA045069) at Atlas Antibodies

Documents & Links for Anti MAPK11 pAb (ATL-HPA045069)
Datasheet Anti MAPK11 pAb (ATL-HPA045069) Datasheet (External Link)
Vendor Page Anti MAPK11 pAb (ATL-HPA045069)