Anti MAP4K5 pAb (ATL-HPA078030)
Atlas Antibodies
- Catalog No.:
- ATL-HPA078030-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MAP4K5
Alternative Gene Name: GCKR, KHS, KHS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034761: 98%, ENSRNOG00000004923: 96%
Entrez Gene ID: 11183
Uniprot ID: Q9Y4K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | WLYVINNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRI |
| Gene Sequence | WLYVINNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRI |
| Gene ID - Mouse | ENSMUSG00000034761 |
| Gene ID - Rat | ENSRNOG00000004923 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAP4K5 pAb (ATL-HPA078030) | |
| Datasheet | Anti MAP4K5 pAb (ATL-HPA078030) Datasheet (External Link) |
| Vendor Page | Anti MAP4K5 pAb (ATL-HPA078030) at Atlas Antibodies |
| Documents & Links for Anti MAP4K5 pAb (ATL-HPA078030) | |
| Datasheet | Anti MAP4K5 pAb (ATL-HPA078030) Datasheet (External Link) |
| Vendor Page | Anti MAP4K5 pAb (ATL-HPA078030) |