Anti MAP4K5 pAb (ATL-HPA078030)

Atlas Antibodies

SKU: ATL-HPA078030-25

• 

Protein Description: mitogen-activated protein kinase kinase kinase kinase 5
Gene Name: MAP4K5
Alternative Gene Name: GCKR, KHS, KHS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034761: 98%, ENSRNOG00000004923: 96%
Entrez Gene ID: 11183
Uniprot ID: Q9Y4K4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WLYVINNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRI
• Gene Sequence: WLYVINNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRI
• Gene ID - Mouse: ENSMUSG00000034761
• Gene ID - Rat: ENSRNOG00000004923
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.