Anti MAP3K6 pAb (ATL-HPA051192)

Atlas Antibodies

Catalog No.:
ATL-HPA051192-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitogen-activated protein kinase kinase kinase 6
Gene Name: MAP3K6
Alternative Gene Name: ASK2, MAPKKK6, MEKK6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028862: 81%, ENSRNOG00000008936: 84%
Entrez Gene ID: 9064
Uniprot ID: O95382
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EEPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLHQEQKQEQGARLGRNHVEELLRCLGAHIHTPNRR
Gene Sequence EEPASPEESSGLSLLHQESKRRAMLAAVLEQELPALAENLHQEQKQEQGARLGRNHVEELLRCLGAHIHTPNRR
Gene ID - Mouse ENSMUSG00000028862
Gene ID - Rat ENSRNOG00000008936
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAP3K6 pAb (ATL-HPA051192)
Datasheet Anti MAP3K6 pAb (ATL-HPA051192) Datasheet (External Link)
Vendor Page Anti MAP3K6 pAb (ATL-HPA051192) at Atlas Antibodies

Documents & Links for Anti MAP3K6 pAb (ATL-HPA051192)
Datasheet Anti MAP3K6 pAb (ATL-HPA051192) Datasheet (External Link)
Vendor Page Anti MAP3K6 pAb (ATL-HPA051192)