Anti MAP3K2 pAb (ATL-HPA021540)

Atlas Antibodies

Catalog No.: ATL-HPA021540-25

Protein Description: mitogen-activated protein kinase kinase kinase 2
Gene Name: MAP3K2
Alternative Gene Name: MEKK2, MEKK2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024383: 91%, ENSRNOG00000014089: 91%
Entrez Gene ID: 10746
Uniprot ID: Q9Y2U5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMDQM
• Gene Sequence: IAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPLPSLEDLDNTVFGAERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPESMDQM
• Gene ID - Mouse: ENSMUSG00000024383
• Gene ID - Rat: ENSRNOG00000014089
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.