Anti MAP3K12 pAb (ATL-HPA071996)

Atlas Antibodies

Catalog No.:
ATL-HPA071996-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mitogen-activated protein kinase kinase kinase 12
Gene Name: MAP3K12
Alternative Gene Name: DLK, MEKK12, MUK, ZPK, ZPKP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023050: 100%, ENSRNOG00000015134: 100%
Entrez Gene ID: 7786
Uniprot ID: Q12852
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDL
Gene Sequence LLHGNTMEKLIKKRNVPQKLSPHSKRPDILKTESLLPKLDAALSGVGLPGCPKGPPSPGRSRRGKTRHRKASAKGSCGDL
Gene ID - Mouse ENSMUSG00000023050
Gene ID - Rat ENSRNOG00000015134
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAP3K12 pAb (ATL-HPA071996)
Datasheet Anti MAP3K12 pAb (ATL-HPA071996) Datasheet (External Link)
Vendor Page Anti MAP3K12 pAb (ATL-HPA071996) at Atlas Antibodies

Documents & Links for Anti MAP3K12 pAb (ATL-HPA071996)
Datasheet Anti MAP3K12 pAb (ATL-HPA071996) Datasheet (External Link)
Vendor Page Anti MAP3K12 pAb (ATL-HPA071996)