Anti MAP2K2 pAb (ATL-HPA051993)

Atlas Antibodies

Catalog No.:
ATL-HPA051993-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: mitogen-activated protein kinase kinase 2
Gene Name: MAP2K2
Alternative Gene Name: MEK2, PRKMK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035027: 100%, ENSRNOG00000020005: 98%
Entrez Gene ID: 5605
Uniprot ID: P36507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEEL
Gene Sequence MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEEL
Gene ID - Mouse ENSMUSG00000035027
Gene ID - Rat ENSRNOG00000020005
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAP2K2 pAb (ATL-HPA051993)
Datasheet Anti MAP2K2 pAb (ATL-HPA051993) Datasheet (External Link)
Vendor Page Anti MAP2K2 pAb (ATL-HPA051993) at Atlas Antibodies

Documents & Links for Anti MAP2K2 pAb (ATL-HPA051993)
Datasheet Anti MAP2K2 pAb (ATL-HPA051993) Datasheet (External Link)
Vendor Page Anti MAP2K2 pAb (ATL-HPA051993)