Anti MAP2K2 pAb (ATL-HPA051993)

Atlas Antibodies

Catalog No.: ATL-HPA051993-25

Protein Description: mitogen-activated protein kinase kinase 2
Gene Name: MAP2K2
Alternative Gene Name: MEK2, PRKMK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035027: 100%, ENSRNOG00000020005: 98%
Entrez Gene ID: 5605
Uniprot ID: P36507
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEEL
• Gene Sequence: MLARRKPVLPALTINPTIAEGPSPTSEGASEANLVDLQKKLEEL
• Gene ID - Mouse: ENSMUSG00000035027
• Gene ID - Rat: ENSRNOG00000020005
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.