Anti MAP1S pAb (ATL-HPA050934)
Atlas Antibodies
- Catalog No.:
- ATL-HPA050934-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MAP1S
Alternative Gene Name: BPY2IP1, C19orf5, FLJ10669, MAP8, VCY2IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019261: 59%, ENSRNOG00000018781: 62%
Entrez Gene ID: 55201
Uniprot ID: Q66K74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSAR |
| Gene Sequence | GFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSAR |
| Gene ID - Mouse | ENSMUSG00000019261 |
| Gene ID - Rat | ENSRNOG00000018781 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAP1S pAb (ATL-HPA050934) | |
| Datasheet | Anti MAP1S pAb (ATL-HPA050934) Datasheet (External Link) |
| Vendor Page | Anti MAP1S pAb (ATL-HPA050934) at Atlas Antibodies |
| Documents & Links for Anti MAP1S pAb (ATL-HPA050934) | |
| Datasheet | Anti MAP1S pAb (ATL-HPA050934) Datasheet (External Link) |
| Vendor Page | Anti MAP1S pAb (ATL-HPA050934) |
| Citations for Anti MAP1S pAb (ATL-HPA050934) – 1 Found |
| Baltussen, Lucas L; Negraes, Priscilla D; Silvestre, Margaux; Claxton, Suzanne; Moeskops, Max; Christodoulou, Evangelos; Flynn, Helen R; Snijders, Ambrosius P; Muotri, Alysson R; Ultanir, Sila K. Chemical genetic identification of CDKL5 substrates reveals its role in neuronal microtubule dynamics. The Embo Journal. 2018;37(24) PubMed |