Anti MAP1S pAb (ATL-HPA050934)

Atlas Antibodies

Catalog No.: ATL-HPA050934-25

Protein Description: microtubule-associated protein 1S
Gene Name: MAP1S
Alternative Gene Name: BPY2IP1, C19orf5, FLJ10669, MAP8, VCY2IP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019261: 59%, ENSRNOG00000018781: 62%
Entrez Gene ID: 55201
Uniprot ID: Q66K74
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSAR
• Gene Sequence: GFGVPRHDPLPDPLKVPPPLPDPSSICMVDPEMLPPKTARQTENVSRTRKPLARPNSRAAAPKATPVAAAKTKGLAGGDRASRPLSAR
• Gene ID - Mouse: ENSMUSG00000019261
• Gene ID - Rat: ENSRNOG00000018781
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAP1S pAb (ATL-HPA050934) – 1 Found

Baltussen, Lucas L; Negraes, Priscilla D; Silvestre, Margaux; Claxton, Suzanne; Moeskops, Max; Christodoulou, Evangelos; Flynn, Helen R; Snijders, Ambrosius P; Muotri, Alysson R; Ultanir, Sila K. Chemical genetic identification of CDKL5 substrates reveals its role in neuronal microtubule dynamics. The Embo Journal. 2018;37(24)