Anti MAP1LC3C pAb (ATL-HPA072670)

Atlas Antibodies

Catalog No.: ATL-HPA072670-25

Protein Description: microtubule-associated protein 1 light chain 3 gamma
Gene Name: MAP1LC3C
Alternative Gene Name: ATG8J
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031812: 50%, ENSRNOG00000038106: 50%
Entrez Gene ID: 440738
Uniprot ID: Q9BXW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKFLVPQELTMTQFLSIIRSRMVLRATEAF
• Gene Sequence: TKFLVPQELTMTQFLSIIRSRMVLRATEAF
• Gene ID - Mouse: ENSMUSG00000031812
• Gene ID - Rat: ENSRNOG00000038106
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.