Anti MAP1LC3C pAb (ATL-HPA072670)
Atlas Antibodies
- Catalog No.:
- ATL-HPA072670-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MAP1LC3C
Alternative Gene Name: ATG8J
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031812: 50%, ENSRNOG00000038106: 50%
Entrez Gene ID: 440738
Uniprot ID: Q9BXW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TKFLVPQELTMTQFLSIIRSRMVLRATEAF |
| Gene Sequence | TKFLVPQELTMTQFLSIIRSRMVLRATEAF |
| Gene ID - Mouse | ENSMUSG00000031812 |
| Gene ID - Rat | ENSRNOG00000038106 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAP1LC3C pAb (ATL-HPA072670) | |
| Datasheet | Anti MAP1LC3C pAb (ATL-HPA072670) Datasheet (External Link) |
| Vendor Page | Anti MAP1LC3C pAb (ATL-HPA072670) at Atlas Antibodies |
| Documents & Links for Anti MAP1LC3C pAb (ATL-HPA072670) | |
| Datasheet | Anti MAP1LC3C pAb (ATL-HPA072670) Datasheet (External Link) |
| Vendor Page | Anti MAP1LC3C pAb (ATL-HPA072670) |