Anti MAP1LC3C pAb (ATL-HPA072670)

Atlas Antibodies

Catalog No.:
ATL-HPA072670-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: microtubule-associated protein 1 light chain 3 gamma
Gene Name: MAP1LC3C
Alternative Gene Name: ATG8J
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031812: 50%, ENSRNOG00000038106: 50%
Entrez Gene ID: 440738
Uniprot ID: Q9BXW4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TKFLVPQELTMTQFLSIIRSRMVLRATEAF
Gene Sequence TKFLVPQELTMTQFLSIIRSRMVLRATEAF
Gene ID - Mouse ENSMUSG00000031812
Gene ID - Rat ENSRNOG00000038106
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAP1LC3C pAb (ATL-HPA072670)
Datasheet Anti MAP1LC3C pAb (ATL-HPA072670) Datasheet (External Link)
Vendor Page Anti MAP1LC3C pAb (ATL-HPA072670) at Atlas Antibodies

Documents & Links for Anti MAP1LC3C pAb (ATL-HPA072670)
Datasheet Anti MAP1LC3C pAb (ATL-HPA072670) Datasheet (External Link)
Vendor Page Anti MAP1LC3C pAb (ATL-HPA072670)