Anti MAP1LC3B pAb (ATL-HPA053767)

Atlas Antibodies

Catalog No.:
ATL-HPA053767-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: microtubule-associated protein 1 light chain 3 beta
Gene Name: MAP1LC3B
Alternative Gene Name: ATG8F
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031812: 97%, ENSRNOG00000017905: 97%
Entrez Gene ID: 81631
Uniprot ID: Q9GZQ8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MPSEKTFKQRRTFEQRVEDVRLIREQHPTK
Gene Sequence MPSEKTFKQRRTFEQRVEDVRLIREQHPTK
Gene ID - Mouse ENSMUSG00000031812
Gene ID - Rat ENSRNOG00000017905
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAP1LC3B pAb (ATL-HPA053767)
Datasheet Anti MAP1LC3B pAb (ATL-HPA053767) Datasheet (External Link)
Vendor Page Anti MAP1LC3B pAb (ATL-HPA053767) at Atlas Antibodies

Documents & Links for Anti MAP1LC3B pAb (ATL-HPA053767)
Datasheet Anti MAP1LC3B pAb (ATL-HPA053767) Datasheet (External Link)
Vendor Page Anti MAP1LC3B pAb (ATL-HPA053767)
Citations for Anti MAP1LC3B pAb (ATL-HPA053767) – 1 Found
Qureshi-Baig, Komal; Kuhn, Diana; Viry, Elodie; Pozdeev, Vitaly I; Schmitz, Martine; Rodriguez, Fabien; Ullmann, Pit; Koncina, Eric; Nurmik, Martin; Frasquilho, Sonia; Nazarov, Petr V; Zuegel, Nikolaus; Boulmont, Marc; Karapetyan, Yervand; Antunes, Laurent; Val, Daniel; Mittelbronn, Michel; Janji, Bassam; Haan, Serge; Letellier, Elisabeth. Hypoxia-induced autophagy drives colorectal cancer initiation and progression by activating the PRKC/PKC-EZR (ezrin) pathway. Autophagy. 2020;16(8):1436-1452.  PubMed