Anti MAP1LC3A pAb (ATL-HPA052474)

Atlas Antibodies

Catalog No.:
ATL-HPA052474-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: microtubule-associated protein 1 light chain 3 alpha
Gene Name: MAP1LC3A
Alternative Gene Name: ATG8E, LC3, LC3A, MAP1ALC3, MAP1BLC3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031812: 97%, ENSRNOG00000017905: 97%
Entrez Gene ID: 84557
Uniprot ID: Q9H492
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG
Gene Sequence NQAFFLLVNGHSMVSVSTPISEVYESEKDEDG
Gene ID - Mouse ENSMUSG00000031812
Gene ID - Rat ENSRNOG00000017905
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAP1LC3A pAb (ATL-HPA052474)
Datasheet Anti MAP1LC3A pAb (ATL-HPA052474) Datasheet (External Link)
Vendor Page Anti MAP1LC3A pAb (ATL-HPA052474) at Atlas Antibodies

Documents & Links for Anti MAP1LC3A pAb (ATL-HPA052474)
Datasheet Anti MAP1LC3A pAb (ATL-HPA052474) Datasheet (External Link)
Vendor Page Anti MAP1LC3A pAb (ATL-HPA052474)