Anti MANEAL pAb (ATL-HPA063423)

Atlas Antibodies

Catalog No.:
ATL-HPA063423-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mannosidase, endo-alpha-like
Gene Name: MANEAL
Alternative Gene Name: FLJ31434
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042763: 100%, ENSRNOG00000025349: 100%
Entrez Gene ID: 149175
Uniprot ID: Q5VSG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FYYSWYGSPRREGHYIHWDHVMVPHWDPKISASY
Gene Sequence FYYSWYGSPRREGHYIHWDHVMVPHWDPKISASY
Gene ID - Mouse ENSMUSG00000042763
Gene ID - Rat ENSRNOG00000025349
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MANEAL pAb (ATL-HPA063423)
Datasheet Anti MANEAL pAb (ATL-HPA063423) Datasheet (External Link)
Vendor Page Anti MANEAL pAb (ATL-HPA063423) at Atlas Antibodies

Documents & Links for Anti MANEAL pAb (ATL-HPA063423)
Datasheet Anti MANEAL pAb (ATL-HPA063423) Datasheet (External Link)
Vendor Page Anti MANEAL pAb (ATL-HPA063423)