Anti MAN1B1 pAb (ATL-HPA051516)

Atlas Antibodies

Catalog No.:
ATL-HPA051516-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mannosidase, alpha, class 1B, member 1
Gene Name: MAN1B1
Alternative Gene Name: MANA-ER, MRT15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036646: 84%, ENSRNOG00000012559: 84%
Entrez Gene ID: 11253
Uniprot ID: Q9UKM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen METGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKP
Gene Sequence METGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKP
Gene ID - Mouse ENSMUSG00000036646
Gene ID - Rat ENSRNOG00000012559
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAN1B1 pAb (ATL-HPA051516)
Datasheet Anti MAN1B1 pAb (ATL-HPA051516) Datasheet (External Link)
Vendor Page Anti MAN1B1 pAb (ATL-HPA051516) at Atlas Antibodies

Documents & Links for Anti MAN1B1 pAb (ATL-HPA051516)
Datasheet Anti MAN1B1 pAb (ATL-HPA051516) Datasheet (External Link)
Vendor Page Anti MAN1B1 pAb (ATL-HPA051516)