Anti MAN1B1 pAb (ATL-HPA051516)

Atlas Antibodies

SKU: ATL-HPA051516-25

• 

Protein Description: mannosidase, alpha, class 1B, member 1
Gene Name: MAN1B1
Alternative Gene Name: MANA-ER, MRT15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036646: 84%, ENSRNOG00000012559: 84%
Entrez Gene ID: 11253
Uniprot ID: Q9UKM7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: METGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKP
• Gene Sequence: METGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKP
• Gene ID - Mouse: ENSMUSG00000036646
• Gene ID - Rat: ENSRNOG00000012559
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.