Anti MAN1A1 pAb (ATL-HPA053198)

Atlas Antibodies

Catalog No.:
ATL-HPA053198-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mannosidase, alpha, class 1A, member 1
Gene Name: MAN1A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003746: 86%, ENSRNOG00000000800: 86%
Entrez Gene ID: 4121
Uniprot ID: P33908
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK
Gene Sequence TLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPIGVESREPADAAIREK
Gene ID - Mouse ENSMUSG00000003746
Gene ID - Rat ENSRNOG00000000800
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAN1A1 pAb (ATL-HPA053198)
Datasheet Anti MAN1A1 pAb (ATL-HPA053198) Datasheet (External Link)
Vendor Page Anti MAN1A1 pAb (ATL-HPA053198) at Atlas Antibodies

Documents & Links for Anti MAN1A1 pAb (ATL-HPA053198)
Datasheet Anti MAN1A1 pAb (ATL-HPA053198) Datasheet (External Link)
Vendor Page Anti MAN1A1 pAb (ATL-HPA053198)