Anti MAMSTR pAb (ATL-HPA049765)
Atlas Antibodies
- SKU:
- ATL-HPA049765-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MAMSTR
Alternative Gene Name: FLJ36070, MASTR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042918: 74%, ENSRNOG00000024580: 74%
Entrez Gene ID: 284358
Uniprot ID: Q6ZN01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQ |
Gene Sequence | PPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQ |
Gene ID - Mouse | ENSMUSG00000042918 |
Gene ID - Rat | ENSRNOG00000024580 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MAMSTR pAb (ATL-HPA049765) | |
Datasheet | Anti MAMSTR pAb (ATL-HPA049765) Datasheet (External Link) |
Vendor Page | Anti MAMSTR pAb (ATL-HPA049765) at Atlas Antibodies |
Documents & Links for Anti MAMSTR pAb (ATL-HPA049765) | |
Datasheet | Anti MAMSTR pAb (ATL-HPA049765) Datasheet (External Link) |
Vendor Page | Anti MAMSTR pAb (ATL-HPA049765) |