Anti MAMSTR pAb (ATL-HPA049765)

Atlas Antibodies

Catalog No.:
ATL-HPA049765-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MEF2 activating motif and SAP domain containing transcriptional regulator
Gene Name: MAMSTR
Alternative Gene Name: FLJ36070, MASTR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042918: 74%, ENSRNOG00000024580: 74%
Entrez Gene ID: 284358
Uniprot ID: Q6ZN01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQ
Gene Sequence PPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQ
Gene ID - Mouse ENSMUSG00000042918
Gene ID - Rat ENSRNOG00000024580
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAMSTR pAb (ATL-HPA049765)
Datasheet Anti MAMSTR pAb (ATL-HPA049765) Datasheet (External Link)
Vendor Page Anti MAMSTR pAb (ATL-HPA049765) at Atlas Antibodies

Documents & Links for Anti MAMSTR pAb (ATL-HPA049765)
Datasheet Anti MAMSTR pAb (ATL-HPA049765) Datasheet (External Link)
Vendor Page Anti MAMSTR pAb (ATL-HPA049765)