Anti MAMSTR pAb (ATL-HPA049765)

Atlas Antibodies

SKU: ATL-HPA049765-25

• 

Protein Description: MEF2 activating motif and SAP domain containing transcriptional regulator
Gene Name: MAMSTR
Alternative Gene Name: FLJ36070, MASTR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042918: 74%, ENSRNOG00000024580: 74%
Entrez Gene ID: 284358
Uniprot ID: Q6ZN01
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQ
• Gene Sequence: PPGPSLWEGTDSQQPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQ
• Gene ID - Mouse: ENSMUSG00000042918
• Gene ID - Rat: ENSRNOG00000024580
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.