Anti MAGI1 pAb (ATL-HPA077002)

Atlas Antibodies

SKU: ATL-HPA077002-25

• 

Protein Description: membrane associated guanylate kinase, WW and PDZ domain containing 1
Gene Name: MAGI1
Alternative Gene Name: AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045095: 94%, ENSRNOG00000022060: 94%
Entrez Gene ID: 9223
Uniprot ID: Q96QZ7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEFKAPQATQEQDF
• Gene Sequence: ITNKSHSDIVNLIKEAGNTVTLRIIPGDESSNATLLTNAEKIATITTTHTPSQQGTQETRNTTKPKQESQFEFKAPQATQEQDF
• Gene ID - Mouse: ENSMUSG00000045095
• Gene ID - Rat: ENSRNOG00000022060
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.