Anti MAGEC3 pAb (ATL-HPA052067)

Atlas Antibodies

SKU: ATL-HPA052067-25

• 

Protein Description: melanoma antigen family C, 3
Gene Name: MAGEC3
Alternative Gene Name: CT7.2, HCA2, MAGE-C3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000938: 40%, ENSRNOG00000027246: 42%
Entrez Gene ID: 139081
Uniprot ID: Q8TD91
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGMPPLPQSPPEIPPQGPPKISPQGPPQSPPQSPLDSCSSPLLWTRLDEESSSEE
• Gene Sequence: AGMPPLPQSPPEIPPQGPPKISPQGPPQSPPQSPLDSCSSPLLWTRLDEESSSEE
• Gene ID - Mouse: ENSMUSG00000000938
• Gene ID - Rat: ENSRNOG00000027246
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti MAGEC3 pAb (ATL-HPA052067) – 1 Found

Ellegate, James Jr; Mastri, Michalis; Isenhart, Emily; Krolewski, John J; Chatta, Gurkamal; Kauffman, Eric; Moffitt, Melissa; Eng, Kevin H. Loss of MAGEC3 Expression Is Associated with Prognosis in Advanced Ovarian Cancers. Cancers. 2022;14(3)