Anti MAGEB5 pAb (ATL-HPA052627)
Atlas Antibodies
- Catalog No.:
- ATL-HPA052627-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: MAGEB5
Alternative Gene Name: CT3.3, MAGE-B5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043453: 33%, ENSRNOG00000052773: 30%
Entrez Gene ID: 347541
Uniprot ID: Q9BZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLY |
Gene Sequence | NAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLY |
Gene ID - Mouse | ENSMUSG00000043453 |
Gene ID - Rat | ENSRNOG00000052773 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MAGEB5 pAb (ATL-HPA052627) | |
Datasheet | Anti MAGEB5 pAb (ATL-HPA052627) Datasheet (External Link) |
Vendor Page | Anti MAGEB5 pAb (ATL-HPA052627) at Atlas Antibodies |
Documents & Links for Anti MAGEB5 pAb (ATL-HPA052627) | |
Datasheet | Anti MAGEB5 pAb (ATL-HPA052627) Datasheet (External Link) |
Vendor Page | Anti MAGEB5 pAb (ATL-HPA052627) |