Anti MAGEB5 pAb (ATL-HPA052627)

Atlas Antibodies

Catalog No.:
ATL-HPA052627-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: melanoma antigen family B, 5
Gene Name: MAGEB5
Alternative Gene Name: CT3.3, MAGE-B5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043453: 33%, ENSRNOG00000052773: 30%
Entrez Gene ID: 347541
Uniprot ID: Q9BZ81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLY
Gene Sequence NAGSDERANSRDEEYPCSSEVSPSTESSCSNFINIKVGLLEQFLLY
Gene ID - Mouse ENSMUSG00000043453
Gene ID - Rat ENSRNOG00000052773
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAGEB5 pAb (ATL-HPA052627)
Datasheet Anti MAGEB5 pAb (ATL-HPA052627) Datasheet (External Link)
Vendor Page Anti MAGEB5 pAb (ATL-HPA052627) at Atlas Antibodies

Documents & Links for Anti MAGEB5 pAb (ATL-HPA052627)
Datasheet Anti MAGEB5 pAb (ATL-HPA052627) Datasheet (External Link)
Vendor Page Anti MAGEB5 pAb (ATL-HPA052627)