Anti MAGEB2 pAb (ATL-HPA075519 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075519-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MAGEB2
Alternative Gene Name: CT3.2, DAM6, MAGE-XP-2, MGC26438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073069: 43%, ENSRNOG00000055102: 40%
Entrez Gene ID: 4113
Uniprot ID: O15479
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP |
Gene Sequence | EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP |
Gene ID - Mouse | ENSMUSG00000073069 |
Gene ID - Rat | ENSRNOG00000055102 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MAGEB2 pAb (ATL-HPA075519 w/enhanced validation) | |
Datasheet | Anti MAGEB2 pAb (ATL-HPA075519 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MAGEB2 pAb (ATL-HPA075519 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti MAGEB2 pAb (ATL-HPA075519 w/enhanced validation) | |
Datasheet | Anti MAGEB2 pAb (ATL-HPA075519 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti MAGEB2 pAb (ATL-HPA075519 w/enhanced validation) |