Anti MAGEB2 pAb (ATL-HPA065224)

Atlas Antibodies

SKU:
ATL-HPA065224-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: melanoma antigen family B2
Gene Name: MAGEB2
Alternative Gene Name: CT3.2, DAM6, MAGE-XP-2, MGC26438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073069: 43%, ENSRNOG00000055102: 40%
Entrez Gene ID: 4113
Uniprot ID: O15479
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
Gene Sequence EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
Gene ID - Mouse ENSMUSG00000073069
Gene ID - Rat ENSRNOG00000055102
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MAGEB2 pAb (ATL-HPA065224)
Datasheet Anti MAGEB2 pAb (ATL-HPA065224) Datasheet (External Link)
Vendor Page Anti MAGEB2 pAb (ATL-HPA065224) at Atlas Antibodies

Documents & Links for Anti MAGEB2 pAb (ATL-HPA065224)
Datasheet Anti MAGEB2 pAb (ATL-HPA065224) Datasheet (External Link)
Vendor Page Anti MAGEB2 pAb (ATL-HPA065224)