Anti MAGEB2 pAb (ATL-HPA065224)

Atlas Antibodies

Catalog No.: ATL-HPA065224-25

Protein Description: melanoma antigen family B2
Gene Name: MAGEB2
Alternative Gene Name: CT3.2, DAM6, MAGE-XP-2, MGC26438
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073069: 43%, ENSRNOG00000055102: 40%
Entrez Gene ID: 4113
Uniprot ID: O15479
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
• Gene Sequence: EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
• Gene ID - Mouse: ENSMUSG00000073069
• Gene ID - Rat: ENSRNOG00000055102
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.