Anti MAGEA11 pAb (ATL-HPA052687)

Atlas Antibodies

Catalog No.:
ATL-HPA052687-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: melanoma antigen family A11
Gene Name: MAGEA11
Alternative Gene Name: CT1.11, MAGE-11, MAGE11, MAGEA-11, MGC10511
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031179: 45%, ENSRNOG00000054784: 43%
Entrez Gene ID: 4110
Uniprot ID: P43364
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEM
Gene Sequence PSTSPDLIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEM
Gene ID - Mouse ENSMUSG00000031179
Gene ID - Rat ENSRNOG00000054784
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAGEA11 pAb (ATL-HPA052687)
Datasheet Anti MAGEA11 pAb (ATL-HPA052687) Datasheet (External Link)
Vendor Page Anti MAGEA11 pAb (ATL-HPA052687) at Atlas Antibodies

Documents & Links for Anti MAGEA11 pAb (ATL-HPA052687)
Datasheet Anti MAGEA11 pAb (ATL-HPA052687) Datasheet (External Link)
Vendor Page Anti MAGEA11 pAb (ATL-HPA052687)