Anti MAF1 pAb (ATL-HPA024821)
Atlas Antibodies
- Catalog No.:
- ATL-HPA024821-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: MAF1
Alternative Gene Name: DKFZp586G1123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022553: 100%, ENSRNOG00000013514: 100%
Entrez Gene ID: 84232
Uniprot ID: Q9H063
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLS |
| Gene Sequence | MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLS |
| Gene ID - Mouse | ENSMUSG00000022553 |
| Gene ID - Rat | ENSRNOG00000013514 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAF1 pAb (ATL-HPA024821) | |
| Datasheet | Anti MAF1 pAb (ATL-HPA024821) Datasheet (External Link) |
| Vendor Page | Anti MAF1 pAb (ATL-HPA024821) at Atlas Antibodies |
| Documents & Links for Anti MAF1 pAb (ATL-HPA024821) | |
| Datasheet | Anti MAF1 pAb (ATL-HPA024821) Datasheet (External Link) |
| Vendor Page | Anti MAF1 pAb (ATL-HPA024821) |