Anti MAF1 pAb (ATL-HPA024821)

Atlas Antibodies

Catalog No.:
ATL-HPA024821-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: MAF1 homolog (S. cerevisiae)
Gene Name: MAF1
Alternative Gene Name: DKFZp586G1123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022553: 100%, ENSRNOG00000013514: 100%
Entrez Gene ID: 84232
Uniprot ID: Q9H063
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLS
Gene Sequence MKLLENSSFEAINSQLTVETGDAHIIGRIESYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLS
Gene ID - Mouse ENSMUSG00000022553
Gene ID - Rat ENSRNOG00000013514
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAF1 pAb (ATL-HPA024821)
Datasheet Anti MAF1 pAb (ATL-HPA024821) Datasheet (External Link)
Vendor Page Anti MAF1 pAb (ATL-HPA024821) at Atlas Antibodies

Documents & Links for Anti MAF1 pAb (ATL-HPA024821)
Datasheet Anti MAF1 pAb (ATL-HPA024821) Datasheet (External Link)
Vendor Page Anti MAF1 pAb (ATL-HPA024821)