Anti MAEL pAb (ATL-HPA078602)

Atlas Antibodies

SKU: ATL-HPA078602-25

• 

Protein Description: maelstrom spermatogenic transposon silencer
Gene Name: MAEL
Alternative Gene Name: CT128, FLJ14904, SPATA35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040629: 90%, ENSRNOG00000003790: 90%
Entrez Gene ID: 84944
Uniprot ID: Q96JY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH
• Gene Sequence: PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH
• Gene ID - Mouse: ENSMUSG00000040629
• Gene ID - Rat: ENSRNOG00000003790
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.