Anti MAEL pAb (ATL-HPA078602)

Atlas Antibodies

Catalog No.:
ATL-HPA078602-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: maelstrom spermatogenic transposon silencer
Gene Name: MAEL
Alternative Gene Name: CT128, FLJ14904, SPATA35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040629: 90%, ENSRNOG00000003790: 90%
Entrez Gene ID: 84944
Uniprot ID: Q96JY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH
Gene Sequence PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH
Gene ID - Mouse ENSMUSG00000040629
Gene ID - Rat ENSRNOG00000003790
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAEL pAb (ATL-HPA078602)
Datasheet Anti MAEL pAb (ATL-HPA078602) Datasheet (External Link)
Vendor Page Anti MAEL pAb (ATL-HPA078602) at Atlas Antibodies

Documents & Links for Anti MAEL pAb (ATL-HPA078602)
Datasheet Anti MAEL pAb (ATL-HPA078602) Datasheet (External Link)
Vendor Page Anti MAEL pAb (ATL-HPA078602)