Anti MAEL pAb (ATL-HPA078602)
Atlas Antibodies
- Catalog No.:
- ATL-HPA078602-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MAEL
Alternative Gene Name: CT128, FLJ14904, SPATA35
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040629: 90%, ENSRNOG00000003790: 90%
Entrez Gene ID: 84944
Uniprot ID: Q96JY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH |
Gene Sequence | PVFTPLRRPGMLVPKQNVSPPDMSALSLKGDQALLGGIFYFLNIFSHGELPPHCEQRFLPCEIGCVKYSLQEGIMADFH |
Gene ID - Mouse | ENSMUSG00000040629 |
Gene ID - Rat | ENSRNOG00000003790 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti MAEL pAb (ATL-HPA078602) | |
Datasheet | Anti MAEL pAb (ATL-HPA078602) Datasheet (External Link) |
Vendor Page | Anti MAEL pAb (ATL-HPA078602) at Atlas Antibodies |
Documents & Links for Anti MAEL pAb (ATL-HPA078602) | |
Datasheet | Anti MAEL pAb (ATL-HPA078602) Datasheet (External Link) |
Vendor Page | Anti MAEL pAb (ATL-HPA078602) |