Anti MAEA pAb (ATL-HPA058185)

Atlas Antibodies

SKU:
ATL-HPA058185-25
  • Immunohistochemical staining of human colon shows strong nuclear and cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: macrophage erythroblast attacher
Gene Name: MAEA
Alternative Gene Name: EMP, GID9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079562: 99%, ENSRNOG00000005397: 99%
Entrez Gene ID: 10296
Uniprot ID: Q7L5Y9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKL
Gene Sequence GVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKL
Gene ID - Mouse ENSMUSG00000079562
Gene ID - Rat ENSRNOG00000005397
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti MAEA pAb (ATL-HPA058185)
Datasheet Anti MAEA pAb (ATL-HPA058185) Datasheet (External Link)
Vendor Page Anti MAEA pAb (ATL-HPA058185) at Atlas Antibodies

Documents & Links for Anti MAEA pAb (ATL-HPA058185)
Datasheet Anti MAEA pAb (ATL-HPA058185) Datasheet (External Link)
Vendor Page Anti MAEA pAb (ATL-HPA058185)