Anti MAEA pAb (ATL-HPA058185)

Atlas Antibodies

Catalog No.: ATL-HPA058185-25

Protein Description: macrophage erythroblast attacher
Gene Name: MAEA
Alternative Gene Name: EMP, GID9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079562: 99%, ENSRNOG00000005397: 99%
Entrez Gene ID: 10296
Uniprot ID: Q7L5Y9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKL
• Gene Sequence: GVVEKLSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSSDQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKL
• Gene ID - Mouse: ENSMUSG00000079562
• Gene ID - Rat: ENSRNOG00000005397
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.