Anti MADCAM1 pAb (ATL-HPA077998)

Atlas Antibodies

Catalog No.:
ATL-HPA077998-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: mucosal vascular addressin cell adhesion molecule 1
Gene Name: MADCAM1
Alternative Gene Name: MACAM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006542: 31%, ENSRNOG00000030017: 33%
Entrez Gene ID: 8174
Uniprot ID: Q13477
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YHLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRGTGQVGIS
Gene Sequence YHLWKRCRHLAEDDTHPPASLRLLPQVSAWAGLRGTGQVGIS
Gene ID - Mouse ENSMUSG00000006542
Gene ID - Rat ENSRNOG00000030017
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MADCAM1 pAb (ATL-HPA077998)
Datasheet Anti MADCAM1 pAb (ATL-HPA077998) Datasheet (External Link)
Vendor Page Anti MADCAM1 pAb (ATL-HPA077998) at Atlas Antibodies

Documents & Links for Anti MADCAM1 pAb (ATL-HPA077998)
Datasheet Anti MADCAM1 pAb (ATL-HPA077998) Datasheet (External Link)
Vendor Page Anti MADCAM1 pAb (ATL-HPA077998)