Anti MACROD1 pAb (ATL-HPA071075)

Atlas Antibodies

Catalog No.:
ATL-HPA071075-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: MACRO domain containing 1
Gene Name: MACROD1
Alternative Gene Name: LRP16
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036278: 91%, ENSRNOG00000021174: 91%
Entrez Gene ID: 28992
Uniprot ID: Q9BQ69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA
Gene Sequence AEIVLATLREWLEQHKDKVDRLIICVFLEKDEDIYRSRLPHYFPVA
Gene ID - Mouse ENSMUSG00000036278
Gene ID - Rat ENSRNOG00000021174
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MACROD1 pAb (ATL-HPA071075)
Datasheet Anti MACROD1 pAb (ATL-HPA071075) Datasheet (External Link)
Vendor Page Anti MACROD1 pAb (ATL-HPA071075) at Atlas Antibodies

Documents & Links for Anti MACROD1 pAb (ATL-HPA071075)
Datasheet Anti MACROD1 pAb (ATL-HPA071075) Datasheet (External Link)
Vendor Page Anti MACROD1 pAb (ATL-HPA071075)