Anti MAB21L1 pAb (ATL-HPA059864)

Atlas Antibodies

Catalog No.:
ATL-HPA059864-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: mab-21-like 1 (C. elegans)
Gene Name: MAB21L1
Alternative Gene Name: CAGR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057777: 100%, ENSRNOG00000032941: 100%
Entrez Gene ID: 4081
Uniprot ID: Q13394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK
Gene Sequence SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK
Gene ID - Mouse ENSMUSG00000057777
Gene ID - Rat ENSRNOG00000032941
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti MAB21L1 pAb (ATL-HPA059864)
Datasheet Anti MAB21L1 pAb (ATL-HPA059864) Datasheet (External Link)
Vendor Page Anti MAB21L1 pAb (ATL-HPA059864) at Atlas Antibodies

Documents & Links for Anti MAB21L1 pAb (ATL-HPA059864)
Datasheet Anti MAB21L1 pAb (ATL-HPA059864) Datasheet (External Link)
Vendor Page Anti MAB21L1 pAb (ATL-HPA059864)