Anti MAB21L1 pAb (ATL-HPA059864)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059864-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: MAB21L1
Alternative Gene Name: CAGR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057777: 100%, ENSRNOG00000032941: 100%
Entrez Gene ID: 4081
Uniprot ID: Q13394
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK |
| Gene Sequence | SPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVK |
| Gene ID - Mouse | ENSMUSG00000057777 |
| Gene ID - Rat | ENSRNOG00000032941 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti MAB21L1 pAb (ATL-HPA059864) | |
| Datasheet | Anti MAB21L1 pAb (ATL-HPA059864) Datasheet (External Link) |
| Vendor Page | Anti MAB21L1 pAb (ATL-HPA059864) at Atlas Antibodies |
| Documents & Links for Anti MAB21L1 pAb (ATL-HPA059864) | |
| Datasheet | Anti MAB21L1 pAb (ATL-HPA059864) Datasheet (External Link) |
| Vendor Page | Anti MAB21L1 pAb (ATL-HPA059864) |