Anti M1AP pAb (ATL-HPA059302)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059302-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: M1AP
Alternative Gene Name: C2orf65, D6Mm5e, SPATA37
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030041: 81%, ENSRNOG00000007288: 80%
Entrez Gene ID: 130951
Uniprot ID: Q8TC57
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQDQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSR |
| Gene Sequence | PSWADICTNLCEALQNFFSLACSLMGPSRMSLFSLYMVQDQHECILPFVQVKGNFARLQTCISELRMLQREGCFRSQGASLRLAVEDGLQQFKQYSR |
| Gene ID - Mouse | ENSMUSG00000030041 |
| Gene ID - Rat | ENSRNOG00000007288 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti M1AP pAb (ATL-HPA059302) | |
| Datasheet | Anti M1AP pAb (ATL-HPA059302) Datasheet (External Link) |
| Vendor Page | Anti M1AP pAb (ATL-HPA059302) at Atlas Antibodies |
| Documents & Links for Anti M1AP pAb (ATL-HPA059302) | |
| Datasheet | Anti M1AP pAb (ATL-HPA059302) Datasheet (External Link) |
| Vendor Page | Anti M1AP pAb (ATL-HPA059302) |