Anti LZTS1 pAb (ATL-HPA006294)

Atlas Antibodies

Catalog No.: ATL-HPA006294-25

Protein Description: leucine zipper, putative tumor suppressor 1
Gene Name: LZTS1
Alternative Gene Name: FEZ1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036306: 85%, ENSRNOG00000011826: 86%
Entrez Gene ID: 11178
Uniprot ID: Q9Y250
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKE
• Gene Sequence: TEVNAKASEILGLKAQLKDTRGKLEGLELRTQDLEGALRTKGLELEVCENELQRKKNEAELLREKVNLLEQELQELRAQAALARDMGPPTFPEDVPALQRELERLRAELREERQGHDQMSSGFQHERLVWKE
• Gene ID - Mouse: ENSMUSG00000036306
• Gene ID - Rat: ENSRNOG00000011826
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti LZTS1 pAb (ATL-HPA006294) – 1 Found

Kawaue, T; Shitamukai, A; Nagasaka, A; Tsunekawa, Y; Shinoda, T; Saito, K; Terada, R; Bilgic, M; Miyata, T; Matsuzaki, F; Kawaguchi, A. Lzts1 controls both neuronal delamination and outer radial glial-like cell generation during mammalian cerebral development. Nature Communications. 2019;10(1):2780.