Anti LZTR1 pAb (ATL-HPA067852)

Atlas Antibodies

Catalog No.:
ATL-HPA067852-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: leucine zipper like transcription regulator 1
Gene Name: LZTR1
Alternative Gene Name: BTBD29, LZTR-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022761: 95%, ENSRNOG00000001870: 95%
Entrez Gene ID: 8216
Uniprot ID: Q8N653
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TQPASELPSGRLFHAAAVISDAMYIFGGTVDNNIRSGEMYRFQFSCYPKCTLHEDYGRLWESRQFCDVEFVLGEKEECVQGHVAIVTA
Gene Sequence TQPASELPSGRLFHAAAVISDAMYIFGGTVDNNIRSGEMYRFQFSCYPKCTLHEDYGRLWESRQFCDVEFVLGEKEECVQGHVAIVTA
Gene ID - Mouse ENSMUSG00000022761
Gene ID - Rat ENSRNOG00000001870
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LZTR1 pAb (ATL-HPA067852)
Datasheet Anti LZTR1 pAb (ATL-HPA067852) Datasheet (External Link)
Vendor Page Anti LZTR1 pAb (ATL-HPA067852) at Atlas Antibodies

Documents & Links for Anti LZTR1 pAb (ATL-HPA067852)
Datasheet Anti LZTR1 pAb (ATL-HPA067852) Datasheet (External Link)
Vendor Page Anti LZTR1 pAb (ATL-HPA067852)