Anti LYZL6 pAb (ATL-HPA053073)
Atlas Antibodies
- Catalog No.:
- ATL-HPA053073-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LYZL6
Alternative Gene Name: LYC1, PRO1485, TKAL754
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020945: 77%, ENSRNOG00000003501: 77%
Entrez Gene ID: 57151
Uniprot ID: O75951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHY |
Gene Sequence | SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHY |
Gene ID - Mouse | ENSMUSG00000020945 |
Gene ID - Rat | ENSRNOG00000003501 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LYZL6 pAb (ATL-HPA053073) | |
Datasheet | Anti LYZL6 pAb (ATL-HPA053073) Datasheet (External Link) |
Vendor Page | Anti LYZL6 pAb (ATL-HPA053073) at Atlas Antibodies |
Documents & Links for Anti LYZL6 pAb (ATL-HPA053073) | |
Datasheet | Anti LYZL6 pAb (ATL-HPA053073) Datasheet (External Link) |
Vendor Page | Anti LYZL6 pAb (ATL-HPA053073) |