Anti LYZL6 pAb (ATL-HPA053073)

Atlas Antibodies

Catalog No.:
ATL-HPA053073-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: lysozyme-like 6
Gene Name: LYZL6
Alternative Gene Name: LYC1, PRO1485, TKAL754
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020945: 77%, ENSRNOG00000003501: 77%
Entrez Gene ID: 57151
Uniprot ID: O75951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHY
Gene Sequence SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHY
Gene ID - Mouse ENSMUSG00000020945
Gene ID - Rat ENSRNOG00000003501
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LYZL6 pAb (ATL-HPA053073)
Datasheet Anti LYZL6 pAb (ATL-HPA053073) Datasheet (External Link)
Vendor Page Anti LYZL6 pAb (ATL-HPA053073) at Atlas Antibodies

Documents & Links for Anti LYZL6 pAb (ATL-HPA053073)
Datasheet Anti LYZL6 pAb (ATL-HPA053073) Datasheet (External Link)
Vendor Page Anti LYZL6 pAb (ATL-HPA053073)