Anti LYZL6 pAb (ATL-HPA025734 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA025734-100

Protein Description: lysozyme-like 6
Gene Name: LYZL6
Alternative Gene Name: LYC1, PRO1485, TKAL754
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020945: 75%, ENSRNOG00000003501: 71%
Entrez Gene ID: 57151
Uniprot ID: O75951
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP
• Gene Sequence: CNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRP
• Gene ID - Mouse: ENSMUSG00000020945
• Gene ID - Rat: ENSRNOG00000003501
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.