Anti LYSMD4 pAb (ATL-HPA059824)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059824-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LYSMD4
Alternative Gene Name: FLJ33008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074570: 26%, ENSRNOG00000038274: 27%
Entrez Gene ID: 145748
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KVFVKGMKKERALGEGAAWWQSQRLVSPGKHDRVSTHRKSQSVFTGVSAGDKQFTTTFSIVFTI |
Gene Sequence | KVFVKGMKKERALGEGAAWWQSQRLVSPGKHDRVSTHRKSQSVFTGVSAGDKQFTTTFSIVFTI |
Gene ID - Mouse | ENSMUSG00000074570 |
Gene ID - Rat | ENSRNOG00000038274 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LYSMD4 pAb (ATL-HPA059824) | |
Datasheet | Anti LYSMD4 pAb (ATL-HPA059824) Datasheet (External Link) |
Vendor Page | Anti LYSMD4 pAb (ATL-HPA059824) at Atlas Antibodies |
Documents & Links for Anti LYSMD4 pAb (ATL-HPA059824) | |
Datasheet | Anti LYSMD4 pAb (ATL-HPA059824) Datasheet (External Link) |
Vendor Page | Anti LYSMD4 pAb (ATL-HPA059824) |