Anti LYSMD4 pAb (ATL-HPA059824)
Atlas Antibodies
- Catalog No.:
- ATL-HPA059824-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LYSMD4
Alternative Gene Name: FLJ33008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074570: 26%, ENSRNOG00000038274: 27%
Entrez Gene ID: 145748
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KVFVKGMKKERALGEGAAWWQSQRLVSPGKHDRVSTHRKSQSVFTGVSAGDKQFTTTFSIVFTI |
| Gene Sequence | KVFVKGMKKERALGEGAAWWQSQRLVSPGKHDRVSTHRKSQSVFTGVSAGDKQFTTTFSIVFTI |
| Gene ID - Mouse | ENSMUSG00000074570 |
| Gene ID - Rat | ENSRNOG00000038274 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LYSMD4 pAb (ATL-HPA059824) | |
| Datasheet | Anti LYSMD4 pAb (ATL-HPA059824) Datasheet (External Link) |
| Vendor Page | Anti LYSMD4 pAb (ATL-HPA059824) at Atlas Antibodies |
| Documents & Links for Anti LYSMD4 pAb (ATL-HPA059824) | |
| Datasheet | Anti LYSMD4 pAb (ATL-HPA059824) Datasheet (External Link) |
| Vendor Page | Anti LYSMD4 pAb (ATL-HPA059824) |