Anti LYSMD4 pAb (ATL-HPA059824)

Atlas Antibodies

Catalog No.:
ATL-HPA059824-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: LysM, putative peptidoglycan-binding, domain containing 4
Gene Name: LYSMD4
Alternative Gene Name: FLJ33008
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000074570: 26%, ENSRNOG00000038274: 27%
Entrez Gene ID: 145748
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KVFVKGMKKERALGEGAAWWQSQRLVSPGKHDRVSTHRKSQSVFTGVSAGDKQFTTTFSIVFTI
Gene Sequence KVFVKGMKKERALGEGAAWWQSQRLVSPGKHDRVSTHRKSQSVFTGVSAGDKQFTTTFSIVFTI
Gene ID - Mouse ENSMUSG00000074570
Gene ID - Rat ENSRNOG00000038274
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LYSMD4 pAb (ATL-HPA059824)
Datasheet Anti LYSMD4 pAb (ATL-HPA059824) Datasheet (External Link)
Vendor Page Anti LYSMD4 pAb (ATL-HPA059824) at Atlas Antibodies

Documents & Links for Anti LYSMD4 pAb (ATL-HPA059824)
Datasheet Anti LYSMD4 pAb (ATL-HPA059824) Datasheet (External Link)
Vendor Page Anti LYSMD4 pAb (ATL-HPA059824)