Anti LYSMD1 pAb (ATL-HPA064537)

Atlas Antibodies

SKU: ATL-HPA064537-25

• 

Protein Description: LysM, putative peptidoglycan-binding, domain containing 1
Gene Name: LYSMD1
Alternative Gene Name: MGC35223, RP11-68I18.5, SB145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094935: 64%, ENSRNOG00000021099: 58%
Entrez Gene ID: 388695
Uniprot ID: Q96S90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQET
• Gene Sequence: PILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQET
• Gene ID - Mouse: ENSMUSG00000094935
• Gene ID - Rat: ENSRNOG00000021099
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.