Anti LYSMD1 pAb (ATL-HPA064537)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064537-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: LYSMD1
Alternative Gene Name: MGC35223, RP11-68I18.5, SB145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094935: 64%, ENSRNOG00000021099: 58%
Entrez Gene ID: 388695
Uniprot ID: Q96S90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQET |
| Gene Sequence | PILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQET |
| Gene ID - Mouse | ENSMUSG00000094935 |
| Gene ID - Rat | ENSRNOG00000021099 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti LYSMD1 pAb (ATL-HPA064537) | |
| Datasheet | Anti LYSMD1 pAb (ATL-HPA064537) Datasheet (External Link) |
| Vendor Page | Anti LYSMD1 pAb (ATL-HPA064537) at Atlas Antibodies |
| Documents & Links for Anti LYSMD1 pAb (ATL-HPA064537) | |
| Datasheet | Anti LYSMD1 pAb (ATL-HPA064537) Datasheet (External Link) |
| Vendor Page | Anti LYSMD1 pAb (ATL-HPA064537) |