Anti LYSMD1 pAb (ATL-HPA064537)

Atlas Antibodies

Catalog No.:
ATL-HPA064537-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: LysM, putative peptidoglycan-binding, domain containing 1
Gene Name: LYSMD1
Alternative Gene Name: MGC35223, RP11-68I18.5, SB145
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000094935: 64%, ENSRNOG00000021099: 58%
Entrez Gene ID: 388695
Uniprot ID: Q96S90
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQET
Gene Sequence PILTEPRDLFNGLDSEEEKDGEEKVHPSNSEVWPHSTERKKQETGAGRANGEVLPTPGQET
Gene ID - Mouse ENSMUSG00000094935
Gene ID - Rat ENSRNOG00000021099
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LYSMD1 pAb (ATL-HPA064537)
Datasheet Anti LYSMD1 pAb (ATL-HPA064537) Datasheet (External Link)
Vendor Page Anti LYSMD1 pAb (ATL-HPA064537) at Atlas Antibodies

Documents & Links for Anti LYSMD1 pAb (ATL-HPA064537)
Datasheet Anti LYSMD1 pAb (ATL-HPA064537) Datasheet (External Link)
Vendor Page Anti LYSMD1 pAb (ATL-HPA064537)