Anti LYRM1 pAb (ATL-HPA059840)

Atlas Antibodies

Catalog No.:
ATL-HPA059840-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: LYR motif containing 1
Gene Name: LYRM1
Alternative Gene Name: A211C6.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030922: 87%, ENSRNOG00000024530: 92%
Entrez Gene ID: 57149
Uniprot ID: O43325
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLIK
Gene Sequence MTTATRQEVLGLYRSIFRLARKWQATSGQMEDTIKEKQYILNEARTLFRKNKNLTDTDLIK
Gene ID - Mouse ENSMUSG00000030922
Gene ID - Rat ENSRNOG00000024530
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LYRM1 pAb (ATL-HPA059840)
Datasheet Anti LYRM1 pAb (ATL-HPA059840) Datasheet (External Link)
Vendor Page Anti LYRM1 pAb (ATL-HPA059840) at Atlas Antibodies

Documents & Links for Anti LYRM1 pAb (ATL-HPA059840)
Datasheet Anti LYRM1 pAb (ATL-HPA059840) Datasheet (External Link)
Vendor Page Anti LYRM1 pAb (ATL-HPA059840)