Anti LYPD5 pAb (ATL-HPA054670)

Atlas Antibodies

Catalog No.:
ATL-HPA054670-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: LY6/PLAUR domain containing 5
Gene Name: LYPD5
Alternative Gene Name: FLJ30469
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030484: 76%, ENSRNOG00000019432: 75%
Entrez Gene ID: 284348
Uniprot ID: Q6UWN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCYSFEHTYFGPFDLRAMKLPSISCPHECFEAILSLDTGYRAPVTLVRKGCWTGPPAGQTQSNPDALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAP
Gene Sequence QCYSFEHTYFGPFDLRAMKLPSISCPHECFEAILSLDTGYRAPVTLVRKGCWTGPPAGQTQSNPDALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAP
Gene ID - Mouse ENSMUSG00000030484
Gene ID - Rat ENSRNOG00000019432
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LYPD5 pAb (ATL-HPA054670)
Datasheet Anti LYPD5 pAb (ATL-HPA054670) Datasheet (External Link)
Vendor Page Anti LYPD5 pAb (ATL-HPA054670) at Atlas Antibodies

Documents & Links for Anti LYPD5 pAb (ATL-HPA054670)
Datasheet Anti LYPD5 pAb (ATL-HPA054670) Datasheet (External Link)
Vendor Page Anti LYPD5 pAb (ATL-HPA054670)