Anti LYPD5 pAb (ATL-HPA054670)
Atlas Antibodies
- Catalog No.:
- ATL-HPA054670-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LYPD5
Alternative Gene Name: FLJ30469
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030484: 76%, ENSRNOG00000019432: 75%
Entrez Gene ID: 284348
Uniprot ID: Q6UWN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QCYSFEHTYFGPFDLRAMKLPSISCPHECFEAILSLDTGYRAPVTLVRKGCWTGPPAGQTQSNPDALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAP |
Gene Sequence | QCYSFEHTYFGPFDLRAMKLPSISCPHECFEAILSLDTGYRAPVTLVRKGCWTGPPAGQTQSNPDALPPDYSVVRGCTTDKCNAHLMTHDALPNLSQAP |
Gene ID - Mouse | ENSMUSG00000030484 |
Gene ID - Rat | ENSRNOG00000019432 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LYPD5 pAb (ATL-HPA054670) | |
Datasheet | Anti LYPD5 pAb (ATL-HPA054670) Datasheet (External Link) |
Vendor Page | Anti LYPD5 pAb (ATL-HPA054670) at Atlas Antibodies |
Documents & Links for Anti LYPD5 pAb (ATL-HPA054670) | |
Datasheet | Anti LYPD5 pAb (ATL-HPA054670) Datasheet (External Link) |
Vendor Page | Anti LYPD5 pAb (ATL-HPA054670) |