Anti LY6H pAb (ATL-HPA077218)

Atlas Antibodies

Catalog No.:
ATL-HPA077218-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: lymphocyte antigen 6 family member H
Gene Name: LY6H
Alternative Gene Name: NMLY6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022577: 95%, ENSRNOG00000007334: 95%
Entrez Gene ID: 4062
Uniprot ID: O94772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASS
Gene Sequence NSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASS
Gene ID - Mouse ENSMUSG00000022577
Gene ID - Rat ENSRNOG00000007334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti LY6H pAb (ATL-HPA077218)
Datasheet Anti LY6H pAb (ATL-HPA077218) Datasheet (External Link)
Vendor Page Anti LY6H pAb (ATL-HPA077218) at Atlas Antibodies

Documents & Links for Anti LY6H pAb (ATL-HPA077218)
Datasheet Anti LY6H pAb (ATL-HPA077218) Datasheet (External Link)
Vendor Page Anti LY6H pAb (ATL-HPA077218)