Anti LY6H pAb (ATL-HPA077218)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077218-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: LY6H
Alternative Gene Name: NMLY6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022577: 95%, ENSRNOG00000007334: 95%
Entrez Gene ID: 4062
Uniprot ID: O94772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASS |
Gene Sequence | NSSHCTPKQCQPSDTVCASVRITDPSSSRKDHSVNKMCASS |
Gene ID - Mouse | ENSMUSG00000022577 |
Gene ID - Rat | ENSRNOG00000007334 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LY6H pAb (ATL-HPA077218) | |
Datasheet | Anti LY6H pAb (ATL-HPA077218) Datasheet (External Link) |
Vendor Page | Anti LY6H pAb (ATL-HPA077218) at Atlas Antibodies |
Documents & Links for Anti LY6H pAb (ATL-HPA077218) | |
Datasheet | Anti LY6H pAb (ATL-HPA077218) Datasheet (External Link) |
Vendor Page | Anti LY6H pAb (ATL-HPA077218) |