Anti LUZP6 pAb (ATL-HPA077907)

Atlas Antibodies

Catalog No.: ATL-HPA077907-25

Protein Description: leucine zipper protein 6
Gene Name: LUZP6
Alternative Gene Name: MPD6, MTPNUT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059206: 30%, ENSRNOG00000003131: 28%
Entrez Gene ID: 767558
Uniprot ID: Q538Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSS
• Gene Sequence: VISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSS
• Gene ID - Mouse: ENSMUSG00000059206
• Gene ID - Rat: ENSRNOG00000003131
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.