Anti LUZP6 pAb (ATL-HPA077907)
Atlas Antibodies
- Catalog No.:
- ATL-HPA077907-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: LUZP6
Alternative Gene Name: MPD6, MTPNUT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059206: 30%, ENSRNOG00000003131: 28%
Entrez Gene ID: 767558
Uniprot ID: Q538Z0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSS |
Gene Sequence | VISYALYQVQTGSLPVYSSVLTKSPLQLQTVIYRLIVQIQHLNIPSSSSTHSS |
Gene ID - Mouse | ENSMUSG00000059206 |
Gene ID - Rat | ENSRNOG00000003131 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti LUZP6 pAb (ATL-HPA077907) | |
Datasheet | Anti LUZP6 pAb (ATL-HPA077907) Datasheet (External Link) |
Vendor Page | Anti LUZP6 pAb (ATL-HPA077907) at Atlas Antibodies |
Documents & Links for Anti LUZP6 pAb (ATL-HPA077907) | |
Datasheet | Anti LUZP6 pAb (ATL-HPA077907) Datasheet (External Link) |
Vendor Page | Anti LUZP6 pAb (ATL-HPA077907) |